PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G405368_P01
Common Namepco105988a, ZEAMMB73_702897
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family CO-like
Protein Properties Length: 428aa    MW: 46210.8 Da    PI: 5.7511
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G405368_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box171.2e-0563105440
           zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40 
                        r C+ +   +   +C+ +  +lC++C +  H        H++v
  GRMZM2G405368_P01  63 RACDGCRAAPSVVYCHADTAYLCASCNSRVHAAnrvasrHERV 105
                        57***************************99556677778766 PP

2zf-B_box231.7e-07105150342
           zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                         r+C+ +e  ++ l C+ +   lC+ C  + H+       H++vp+
  GRMZM2G405368_P01 105 VRVCEACECAPAVLACRADAAALCAACDAQVHSAnplagrHQRVPV 150
                        689*****************************66999999999986 PP

3CCT65.71.3e-22357400144
                CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                        Rea++lRY+eK+k+RkFeK+irY++RK++Ae RpR+KGrF+k++
  GRMZM2G405368_P01 357 REARVLRYREKKKSRKFEKTIRYATRKTYAEARPRIKGRFAKRS 400
                        9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.9460107IPR000315B-box-type zinc finger
SMARTSM003363.4E-560107IPR000315B-box-type zinc finger
CDDcd000211.93E-663107No hitNo description
PROSITE profilePS5011910.836103150IPR000315B-box-type zinc finger
PfamPF006433.9E-7105150IPR000315B-box-type zinc finger
SMARTSM003362.6E-7108150IPR000315B-box-type zinc finger
PfamPF062035.9E-17357399IPR010402CCT domain
PROSITE profilePS5101716.46357399IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0008018anatomytransition vascular leaf
PO:0009025anatomyvascular leaf
PO:0020040anatomyleaf base
PO:0025142anatomyleaf tip
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MTPSVTPWIP LAPTLLLVLC TGLAALWIHH CNFMDYNFDT SVLDEDVAGR GGREGSCPPA  60
WARACDGCRA APSVVYCHAD TAYLCASCNS RVHAANRVAS RHERVRVCEA CECAPAVLAC  120
RADAAALCAA CDAQVHSANP LAGRHQRVPV LPLPAAAVPA ASVLAEAAAT AAAVAGDKDE  180
EVDSWLLLTK DPDDDDKNHN CSSNNNNISS NTSTFYADVD EYFDLVGYSS YCDNHINSNT  240
KQYGMQEQQL LLHKEFGDKE GSEYVVPSQV GQQQSGYHRV IGTEQAASMT PGVSAYTDSI  300
SNSISFSSSM EVGIVPDNMA TTDMPSSGIL LTPAGAISLF SSGPPLQMPL HLASMDREAR  360
VLRYREKKKS RKFEKTIRYA TRKTYAEARP RIKGRFAKRS SDMDVEVDQM FSAAALSSDG  420
SYGTVPWF
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G405368
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G405368_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0981390.0EU098139.1 Zea mays cultivar B73 constans (conz1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001120722.10.0constans 1
SwissprotQ9FDX81e-145HD1_ORYSJ; Zinc finger protein HD1
TrEMBLK7W7Y80.0K7W7Y8_MAIZE; Constans1
STRINGGRMZM2G405368_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-60CONSTANS-like 2